A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10175
Swiss-prot Accession number	Q9TQY7 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Ornithorhynchus anatinus (Duckbill platypus)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Monotremata; Ornithorhynchidae; Ornithorhynchus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5854
References	1  PubMed abstract 8868070
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FPNQHLCGSHLVEALYLVCGEKGFYYIPRM
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10176
Swiss-prot Accession number	Q9TQY7 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Ornithorhynchus anatinus (Duckbill platypus)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Monotremata; Ornithorhynchidae; Ornithorhynchus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5854
References	1  PubMed abstract 8868070
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEECCKGVCSMYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (31-51)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated